AV46881
Anti-LETM1 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Leucine zipper-EF-hand containing transmembrane protein 1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
60 kDa
species reactivity
dog, mouse, horse, guinea pig, bovine, human, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... LETM1(3954)
Immunogen
Synthetic peptide directed towards the middle region of human LETM1
Application
Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.
Biochem/physiol Actions
LETM1 (leucine zipper-EF-hand containing transmembrane protein 1) gene encodes a single-pass membrane protein localized in the inner mitochondrial membrane. It plays a pivotal role in maintaining the mitochondrial tubular shape as well as cristae organization. It also facilitates the normal mitochondrial morphology and cellular viability. Mutation in LETM1 gene leads to Wolf-Hirschhorn syndrome.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Kai Stefan Dimmer et al.
Human molecular genetics, 17(2), 201-214 (2007-10-11)
Wolf-Hirschhorn syndrome (WHS) is a complex congenital syndrome caused by a monoallelic deletion of the short arm of chromosome 4. Seizures in WHS have been associated with deletion of LETM1 gene. LETM1 encodes for the human homologue of yeast Mdm38p
Xiaogang Zhang et al.
Cerebral cortex (New York, N.Y. : 1991), 24(10), 2533-2540 (2013-05-07)
Leucine zipper-EF-hand containing transmembrane protein 1 (Letm1) is a mitochondrial protein that is associated with seizure attacks in Wolf-Hirschhorn syndrome. This study aimed to investigate the expression pattern of Letm1 in patients with temporal lobe epilepsy (TLE) and pilocarpine-induced rat
Shoko Tamai et al.
Journal of cell science, 121(Pt 15), 2588-2600 (2008-07-17)
LETM1 is located in the chromosomal region that is deleted in patients suffering Wolf-Hirschhorn syndrome; it encodes a homolog of the yeast protein Mdm38 that is involved in mitochondrial morphology. Here, we describe the LETM1-mediated regulation of the mitochondrial volume
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service