AV48346
Anti-GADD45B antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-DKFZP566B133, Anti-GADD45BETA, Anti-Growth arrest and DNA-damage-inducible, β, Anti-MYD118
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
lyophilized powder
mol wt
18 kDa
species reactivity
guinea pig, human, bovine, mouse, horse, canine, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... GADD45B(4616)
General description
Growth arrest and DNA-damage-inducible, β (GADD45B) regulates DNA demethylation, adult neurogenesis, p38 signaling and cellular apoptosis. Genetic defects or lack of GADD45B are known to affect long-term memory and synaptic plasticity.
Rabbit Anti-GADD45B antibody recognizes bovine, human, mouse, rat, and canine GADD45B.
Rabbit Anti-GADD45B antibody recognizes bovine, human, mouse, rat, and canine GADD45B.
Immunogen
The immunogen for anti-GADD45B antibody: synthetic peptide derected towards the middle region of human GADD45B
Application
Rabbit Anti-GADD45B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.
Physical form
Lyophilized from PBS buffer with 2% sucrose
Other Notes
Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Dengke K Ma et al.
Science (New York, N.Y.), 323(5917), 1074-1077 (2009-01-03)
The mammalian brain exhibits diverse types of neural plasticity, including activity-dependent neurogenesis in the adult hippocampus. How transient activation of mature neurons leads to long-lasting modulation of adult neurogenesis is unknown. Here we identify Gadd45b as a neural activity-induced immediate
Da-Liang Ou et al.
Cancer research, 70(22), 9309-9318 (2010-11-11)
Markers that could accurately predict responses to the general kinase inhibitor sorafenib are needed to better leverage its clinical applications. In this study, we examined a hypothesized role in the drug response for the growth arrest DNA damage-inducible gene 45β
Faraz A Sultan et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(48), 17059-17066 (2012-12-01)
Dynamic epigenetic mechanisms including histone and DNA modifications regulate animal behavior and memory. While numerous enzymes regulating these mechanisms have been linked to memory formation, the regulation of active DNA demethylation (i.e., cytosine-5 demethylation) has only recently been investigated. New