Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
56 kDa
species reactivity
mouse, guinea pig, bovine, rat, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... OXCT2(64064)
Related Categories
Immunogen
Synthetic peptide directed towards the middle region of human OXCT2
Application
Anti-OXCT2 antibody produced in rabbit is suitable for western blotting (1.0μg/ml) of whole cell extracts of human fibroblasts.
Biochem/physiol Actions
OXCT2 (3-oxoacid CoA transferase 2) is a testis-specific enzyme that catalyzes the reversible transfer of 3-oxoacid CoA transferase 2 in the ketone utilization pathway.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Masayoshi Onishi et al.
Genomics, 83(4), 647-657 (2004-03-19)
OXCT/SCOT is the rate-determining enzyme in ketolysis in mitochondria of many extrahepatic organs. Two testicular isoforms, Oxct2a and Oxct2b, are highly homologous and specifically expressed in haploid spermatids of the mouse. In this report, we analyzed the structure and evolution
Barbara Chiavarina et al.
Cancer biology & therapy, 12(12), 1101-1113 (2012-01-13)
We have previously demonstrated that enhanced aerobic glycolysis and/or autophagy in the tumor stroma supports epithelial cancer cell growth and aggressive behavior, via the secretion of high-energy metabolites. These nutrients include lactate and ketones, as well as chemical building blocks
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service