Skip to Content
Merck
CN

AV48886

Anti-OXCT2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-3-Oxoacid CoA transferase 2, Anti-FKSG25, Anti-FLJ00030, Anti-SCOT-T

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

mouse, guinea pig, bovine, rat, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... OXCT2(64064)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human OXCT2

Application

Anti-OXCT2 antibody produced in rabbit is suitable for western blotting (1.0μg/ml) of whole cell extracts of human fibroblasts.

Biochem/physiol Actions

OXCT2 (3-oxoacid CoA transferase 2) is a testis-specific enzyme that catalyzes the reversible transfer of 3-oxoacid CoA transferase 2 in the ketone utilization pathway.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Masayoshi Onishi et al.
Genomics, 83(4), 647-657 (2004-03-19)
OXCT/SCOT is the rate-determining enzyme in ketolysis in mitochondria of many extrahepatic organs. Two testicular isoforms, Oxct2a and Oxct2b, are highly homologous and specifically expressed in haploid spermatids of the mouse. In this report, we analyzed the structure and evolution
Barbara Chiavarina et al.
Cancer biology & therapy, 12(12), 1101-1113 (2012-01-13)
We have previously demonstrated that enhanced aerobic glycolysis and/or autophagy in the tumor stroma supports epithelial cancer cell growth and aggressive behavior, via the secretion of high-energy metabolites. These nutrients include lactate and ketones, as well as chemical building blocks

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service