Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-C3ORF39 antibody produced in rabbit, IgG fraction of antiserum
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
66 kDa
species reactivity
human, dog, mouse, rat, horse, rabbit, guinea pig, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Quality Level
Gene Information
human ... C3orf39(84892)
Application
Anti-C3ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
C3ORF39 also known as Protein O-linked mannose N-acetylglucosaminyltransferase 2 (POMGNT2; GTDC2) is a protein with glycosyltransferase activity. It is involved in the modification of O-mannosylated α-dystroglycan in the endoplasmic reticulum to generate N-acetyl glucosamine epitopes. Mutations in GTDC2 gene have been identified as the cause of Walker-Warburg syndrome.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human C3orf39
Other Notes
Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
M Chiara Manzini et al.
American journal of human genetics, 91(3), 541-547 (2012-09-11)
Whole-exome sequencing (WES), which analyzes the coding sequence of most annotated genes in the human genome, is an ideal approach to studying fully penetrant autosomal-recessive diseases, and it has been very powerful in identifying disease-causing mutations even when enrollment of
Mitsutaka Ogawa et al.
Biochemical and biophysical research communications, 440(1), 88-93 (2013-09-18)
Hypoglycosylation is a common characteristic of dystroglycanopathy, which is a group of congenital muscular dystrophies. More than ten genes have been implicated in α-dystroglycanopathies that are associated with the defect in the O-mannosylation pathway. One such gene is GTDC2, which
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service