Skip to Content
Merck
CN

AV50093

Sigma-Aldrich

Anti-PIGO antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp434M222, Anti-FLJ00135, Anti-MGC20536, Anti-MGC3079, Anti-Phosphatidylinositol glycan anchor biosynthesis, class O, Anti-RP11-182N22.4

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

74 kDa

species reactivity

guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PIGO(84720)

General description

The previously assigned protein identifier B1AML3 has been merged into Q8TEQ8. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human PIGO

Application

Anti-PIGO antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Phosphatidylinositol glycan anchor biosynthesis, class O (PIGO; HPMRS2) protein is involved in the biosynthesis of glycosylphosphatidylinositol anchor that is present on blood cells and anchors the cell surface proteins. Mutations in PIGO gene results in hyperphosphatasia with mental retardation (HPMRS).

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T Kinoshita et al.
Current opinion in chemical biology, 4(6), 632-638 (2000-12-05)
The pathway for glycosylphosphatidylinositol-anchor biosynthesis consists of at least 10 reaction steps. Many of the genes encoding the enzymes and regulators involved in this pathway have been recently cloned and their products characterised. These studies have revealed the common and
Peter M Krawitz et al.
American journal of human genetics, 91(1), 146-151 (2012-06-12)
Hyperphosphatasia with mental retardation syndrome (HPMRS), an autosomal-recessive form of intellectual disability characterized by facial dysmorphism, seizures, brachytelephalangy, and persistent elevated serum alkaline phosphatase (hyperphosphatasia), was recently shown to be caused by mutations in PIGV, a member of the glycosylphosphatidylinositol

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service