AV50131
Anti-ORAI2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-C7orf19, Anti-CBCIP2, Anti-FLJ12474, Anti-FLJ14733, Anti-ORAI calcium release-activated calcium modulator 2, Anti-TMEM142B
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
28 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ORAI2(80228)
General description
The gene ORAI calcium release-activated calcium modulator 2 (ORAI2) is mapped to human chromosome 7q22.1. ORAI2 is expressed in human platelets and retinal pigment epithelium.
Immunogen
Synthetic peptide directed towards the middle region of human ORAI2
Application
Anti-ORAI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/mL.
Biochem/physiol Actions
ORAI calcium release-activated calcium modulator 2 (ORAI2) is a membrane calcium channel that regulates the influx of calcium into the cells. It is a calcium release-activated calcium (CRAC) channel.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Lutz P Breitling et al.
American journal of human genetics, 88(4), 450-457 (2011-04-05)
Tobacco smoking is responsible for substantial morbidity and mortality worldwide, in particular through cardiovascular, pulmonary, and malignant pathology. CpG methylation might plausibly play a role in a variety of smoking-related phenomena, as suggested by candidate gene promoter or global methylation
Sönke Cordeiro et al.
Graefe's archive for clinical and experimental ophthalmology = Albrecht von Graefes Archiv fur klinische und experimentelle Ophthalmologie, 249(1), 47-54 (2010-07-08)
The retinal pigment epithelium (RPE) fulfills a large variety of tasks that are important for visual function. Many of these tasks, such as phagocytosis, growth factor secretion, or transepithelial ion transport, are regulated by increases in intracellular Ca²(+) as second-messenger.
Wayne I DeHaven et al.
The Journal of biological chemistry, 282(24), 17548-17556 (2007-04-25)
The recent discoveries of Stim1 and Orai proteins have shed light on the molecular makeup of both the endoplasmic reticulum Ca(2+) sensor and the calcium release-activated calcium (CRAC) channel, respectively. In this study, we investigated the regulation of CRAC channel
Alejandro Berna-Erro et al.
Biochimica et biophysica acta, 1823(8), 1242-1251 (2012-05-30)
Discharge of the intracellular Ca(2+) stores activates Ca(2+) entry through store-operated channels (SOCs). Since the recent identification of STIM1 and STIM2, as well as the Orai1 homologs, Orai2 and Orai3, the protein complexes involved in Ca(2+) signaling needs re-evaluation in
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service