Skip to Content
Merck
CN

AV50589

Sigma-Aldrich

Anti-SIN3B (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-KIAA0700, Anti-SIN3 homolog B, transcription Regulator (yeast)

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

133 kDa

species reactivity

mouse, dog, bovine, human, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIN3B(23309)

General description

SIN3B codes for SIN3 transcription regulator family member B that interacts with Mad1. It is also known to form a nucleolar complex with leukemia associated ETO homologs.
Rabbit Anti-SIN3B antibody recognizes human, bovine, and mouse SIN3B.

Immunogen

Synthetic peptide directed towards the middle region of human SIN3B

Application

Rabbit Anti-SIN3B antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

SIN3B acts as a transcriptional repressor. It interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities.It also interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. SIN3B also forms a complex with FOXK1 which represses transcription.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

C A Spronk et al.
Nature structural biology, 7(12), 1100-1104 (2000-12-02)
Sin3A or Sin3B are components of a corepressor complex that mediates repression by transcription factors such as the helix-loop-helix proteins Mad and Mxi. Members of the Mad/Mxi family of repressors play important roles in the transition between proliferation and differentiation
Rakesh Singh Dhanda et al.
BMC molecular biology, 9, 8-8 (2008-01-22)
SIN3 (SWI-Independent) is part of a transcriptional deacetylase complex, which generally mediates the formation of repressive chromatin. The purpose of this work was to study possible interactions between corepressors human SIN3B (hSIN3B) and the ETO homologues - ETO (eight twenty-one)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service