Skip to Content
Merck
CN

AV54579

Anti-GLE1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-GLE1 RNA export mediator homolog (yeast), Anti-GLE1L, Anti-hGLE1

Sign In to View Organizational & Contract Pricing.

Select a Size

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-GLE1 antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

75 kDa

species reactivity

human, horse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_001003722

UniProt accession no.

Q53GS7

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

100

Gene Information

human ... GLE1(2733)

Related Categories

Application

Anti-GLE1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

GLE1 is required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. It may be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC). Mutations in GLE1 result in a fetal motoneuron disease.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GLE1

Other Notes

Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC22673

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Frederic Kendirgi et al.
The Journal of cell biology, 160(7), 1029-1040 (2003-04-02)
Gle1 is required for mRNA export in yeast and human cells. Here, we report that two human Gle1 (hGle1) isoforms are expressed in HeLa cells (hGle1A and B). The two encoded proteins are identical except for their COOH-terminal regions. hGle1A
Frederic Kendirgi et al.
Molecular biology of the cell, 16(9), 4304-4315 (2005-07-08)
Translocation of messenger RNAs through the nuclear pore complex (NPC) requires coordinated physical interactions between stable NPC components, shuttling transport factors, and mRNA-binding proteins. In budding yeast (y) and human (h) cells, Gle1 is an essential mRNA export factor. Nucleocytoplasmic
J L Watkins et al.
Proceedings of the National Academy of Sciences of the United States of America, 95(12), 6779-6784 (1998-06-17)
The mechanism of mRNA export is a complex issue central to cellular physiology. We characterized previously yeast Gle1p, a protein with a leucine-rich (LR) nuclear export sequence (NES) that is essential for poly(A)+ RNA export in Saccharomyces cerevisiae. To characterize
Heidi O Nousiainen et al.
Nature genetics, 40(2), 155-157 (2008-01-22)
The most severe forms of motoneuron disease manifest in utero are characterized by marked atrophy of spinal cord motoneurons and fetal immobility. Here, we report that the defective gene underlying lethal motoneuron syndrome LCCS1 is the mRNA export mediator GLE1.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service