AV54779
Anti-LGALS3BP antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-90K, Anti-Lectin, galactoside-binding, soluble, 3 binding protein, Anti-MAC-2-BP
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
63 kDa
species reactivity
human, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LGALS3BP(3959)
Immunogen
Synthetic peptide directed towards the middle region of human LGALS3BP
Application
Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
LGALS3BP (Lectin, galactoside-binding, soluble, 3 binding protein) or MAC-2-BP gene encodes a Galectin-3-binding protein localized to chromosome 17q25. It is widely expressed by keratinocytes and fibroblasts but is also present in fluids like- semen, milk, serum, tears, saliva and urine. LGALS3BP stimulates the intergrin-mediated cell adhesion. It also imposes stimulatory impact on host defense system like natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Furthermore, the encoded protein interacts specifically with galectin-1 and galectin-3 and facilitates the formation of multicell aggregates.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A Ullrich et al.
The Journal of biological chemistry, 269(28), 18401-18407 (1994-07-15)
Immunization of mice with conditioned media from human breast cancer cells yielded the monoclonal antibody SP-2, which recognized an antigen of approximately 90-95 kDa. This protein, designated 90K, was found to be present in the serum of healthy individuals and
Glycoprotein 90K/MAC-2BP interacts with galectin-1 and mediates galectin-1-induced cell aggregation.
N Tinari et al.
International journal of cancer, 91(2), 167-172 (2001-01-09)
The glycoprotein 90K was originally described as a tumor-secreted antigen and subsequently found to have immunostimulatory activity as well as other possible functions. This protein interacts with an endogenous lectin, galectin-3, and may play a role in tumor metastasis through
K Koths et al.
The Journal of biological chemistry, 268(19), 14245-14249 (1993-07-05)
We have purified and sequenced a secreted glycoprotein from both the human breast carcinoma cell line, SK-BR-3, and human breast milk. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2. This Mac-2 binding protein (Mac-2-BP) has
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service