Skip to Content
Merck
CN

HPA002807

Anti-MFGE8 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

MFG-E8 Antibody - Anti-MFGE8 antibody produced in rabbit, Mfg-E8 Antibody, Anti-Breast epithelial antigen BA46 antibody produced in rabbit, Anti-HMFG antibody produced in rabbit, Anti-Lactadherin precursor antibody produced in rabbit, Anti-MFG-E8 antibody produced in rabbit, Anti-MFGM antibody produced in rabbit, Anti-Milk fat globule-EGF factor 8 antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

Human Protein Atlas Number:
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
12
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLEL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MFGE8(4240)

Looking for similar products? Visit Product Comparison Guide

General description

MFGE8 (milk fat globule-EGF factor 8 protein) is a ~53kDa plasma membrane glycoprotein that is generated at the bud from the apical surface of mammary epithelial cells during lactation. It is composed of two specific functional domains: an N-terminal domain with two epidermal growth factor (EGF) repeats and a C-terminal domain with two Discoidin/F5/8C domains for binding of anionic phospholipids and/or extracellular matrices.
MFGE8 is mapped to human chromosome 15q26.1.

Immunogen

Lactadherin precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-MFGE8 antibody produced in rabbit has been used in immunofluorescence.
Anti-MFGE8 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

MFGE8 (milk fat globule-EGF factor 8) protein is involved in wide range of cellular interactions such as phagocytosis of apoptotic lymphocytes and other apoptotic cells, cell adhesion of sperm and the egg coat, intestinal mucosa repair, mammary gland branching morphogenesis, angiogenesis etc. It is potentially involved in different stages of sperm maturation and fertilization mechanism. It accelerates the engulfment of apoptotic carcinoma cells by living carcinoma cells which in turn promotes tumor growth.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST77458

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

低风险生物材料
常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mutation Identification for Epilepsy in the US Hispanic Population Using Whole-Exome-Sequencing
Villanos M, et al.
Journal of Cell Biology and Cell Metabolism, 3(011) (2016)
Mara D Saenz-de-Juano et al.
BMC genomics, 23(1), 189-189 (2022-03-09)
Subclinical mastitis, the inflammation of the mammary gland lacking clinical symptoms, is one of the most prevalent and costly diseases in dairy farming worldwide. Milk microRNAs (miRNAs) encapsulated in extracellular vesicles (EVs) have been proposed as potential biomarkers of different
Timothy A Reinhardt et al.
Journal of proteomics, 75(5), 1486-1492 (2011-12-02)
Exosomes are 40-100 nm membrane vesicles of endocytic origin, secreted by cells and are found in biological fluids including milk. These exosomes are extracellular organelles important in intracellular communication, and immune function. Therefore, the proteome of bovine milk exosomes may
Timothy A Reinhardt et al.
Journal of proteomics, 82, 141-154 (2013-03-06)
Milk protein expression in healthy cows and cows with mastitis will provide information important for the dairy food industry and immune function in the mammary gland. To facilitate protein discovery, milk was fractioned into whey, milk fat globule membranes (MFGM)
Benedikt Kirchner et al.
PloS one, 15(2), e0229606-e0229606 (2020-02-29)
Extracellular vesicles (EVs) such as exosomes are key regulators of intercellular communication that can be found in almost all bio fluids. Although studies in the last decade have made great headway in discerning the role of EVs in many physiological

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service