Skip to Content
Merck
CN

HPA003563

Anti-C3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARMD9, Anti-C3a, Anti-C3b, Anti-CPAMD1

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
9
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C3(718)

General description

C3 (complement component 3) is the key component of the complement system. It is acted upon by C3 convertases, which produces the activated C3b. It is the predominant protein of the complement system, and is a member of the a2-macroglobulin protein family. It contains a reactive thioester bond, and α- and β-chains of 115 and 75kDa respectively. These together form 13 domains. These domains are divided into single linker (LNK), anaphylatoxin (ANA/C3a), C1r/C1s-UEGF-BMP1 (CUB), C345c, and thioester-containing domains (TED), and namely eight macroglobulin domains (MG1-MG8). The C3 gene is mapped to human chromosome 19p13.3.

Immunogen

Complement C3 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-C3 antibody produced in rabbit has been used in antibody bead arrays to target C3 protein.

Biochem/physiol Actions

C3 (complement component 3) is the key component of the complement system. It is acted upon by C3 convertases, which produces anaphylatoxin C3a and the opsonin C3b. C3a is known to possess antifungal and antimicrobial activity and functions as a chemoattractant. It promotes inflammatory responses such as granule release, formation of oxygen radicals, initiates histamine release, smooth muscle contraction and induces vascular permeability. C3b stimulates opsonophagocytosis and is associated with the production of excess C3 convertases for C5 convertase generation. C3 might reduce the pathogenesis of rhodopsin mutations that leads to retinitis pigmentosa.
Complement component 3 is referred to as C3, ASP, C3a, C3b, AHUS5, ARMD9, CPAMD1 and HEL-S-62p. It is a key fluid-phase protein of the immune system. Complement activation of this gene results in the formation of multiple C3b plasma protein complexes in serum. It helps in recognizing and tags damaged plasma proteins for subsequent removal from the blood without triggering pro-inflammatory functions. The C3 serum levels are associated with ABI and angiographic parameters of atherosclerosis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST78221

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Genomic Characterization of LIGHT Reveals Linkage to an Immune Response Locus on Chromosome 19p13.3 and Distinct Isoforms Generated by Alternate Splicing or Proteolysis
Granger SW
Journal of Immunology, 167 (9), 5122-5128 (2001)
Elizabeth Rodriguez et al.
The Journal of biological chemistry, 290(4), 2334-2350 (2014-12-10)
The solution structure of complement C3b is crucial for the understanding of complement activation and regulation. C3b is generated by the removal of C3a from C3. Hydrolysis of the C3 thioester produces C3u, an analog of C3b. C3b cleavage results
M Fehérvári et al.
International angiology : a journal of the International Union of Angiology, 33(1), 35-41 (2014-01-24)
Recent evidences show correlations between atherosclerosis and the serum level of third component of complement (C3). However, there is less data on the connection of C3 and the severity of atherosclerosis. The aim of our study was to evaluate the



Global Trade Item Number

SKUGTIN
HPA003563-100UL04061836297572
HPA003563-25UL04061842720392