Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
11
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200-1:500
immunogen sequence
FLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESSGHFLVAATGTAAGGGGGLILASPKLGATPLPPESTPA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SALL2(6297)
General description
SALL2 is a multi-zinc finger transcription factor, belongs to the Drosophila homeotic Spalt-like family of developmental transcription factor genes. It is expressed during development of human retina at the time of optic fissure closure.
Immunogen
sal-like 2 (Drosophila) recombinant protein epitope signature tag (PrEST)
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Biochem/physiol Actions
SALL2 specifically performs in growth arrest and pro-apoptotic functions. It is involved in eye morphogenesis. Alteration in the gene function causes ocular coloboma in humans and mice. It has ability to repress the c-MYC transcription by binding to the nuclease hypersensitive element of the c-MYC promoter.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST70589
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-SALL2 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
低风险生物材料
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Viviana E Hermosilla et al.
Molecular oncology, 12(7), 1026-1046 (2018-04-25)
SALL2 is a poorly characterized transcription factor that belongs to the Spalt-like family involved in development. Mutations on SALL2 have been associated with ocular coloboma and cancer. In cancers, SALL2 is deregulated and is proposed as a tumor suppressor in
C Farkas et al.
BMC genomics, 20(1), 131-131 (2019-02-14)
Genetically engineered mice (GEM) are essential tools for understanding gene function and disease modeling. Historically, gene targeting was first done in embryonic stem cells (ESCs) derived from the 129 family of inbred strains, leading to a mixed background or congenic
Carlos Farkas et al.
Frontiers in genetics, 12, 613808-613808 (2021-03-12)
The SALL2 transcription factor, an evolutionarily conserved gene through vertebrates, is involved in normal development and neuronal differentiation. In disease, SALL2 is associated with eye, kidney, and brain disorders, but mainly is related to cancer. Some studies support a tumor
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA004162-25UL | 04061842721641 |
| HPA004162-100UL | 04061837135149 |