Skip to Content
Merck
CN

HPA010860

Anti-SPTLC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LCB 1 antibody produced in rabbit, Anti-Long chain base biosynthesis protein 1 antibody produced in rabbit, Anti-SPT 1 antibody produced in rabbit, Anti-SPT1 antibody produced in rabbit, Anti-Serine palmitoyltransferase 1 antibody produced in rabbit, Anti-Serine-palmitoyl-CoA transferase 1 antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Segment

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50- 1:200

immunogen sequence

KTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPTLC1(10558)

General description

SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) makes a heterodimer with SPTLC2, which forms the enzyme serine palmitoyltransferase (SPT). SPT resides in the outer membrane of endoplasmic reticulum (ER). SPTLC1 gene maps to human chromosome 9q22.2. This protein has a molecular weight of 53kDa, and is expressed in nucleus, focal adhesions as well as ER. It has multiple putative PDZ binding motifs and a transcription cofactor motif (LXXLL).

Immunogen

Serine palmitoyltransferase 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Serine palmitoyltransferase (SPT) participates in sphingolipid biosynthesis by catalyzing the first step. It catalyzes the condensation of L-serine with palmitoyl-CoA. SPTLC1 (serine palmitoyltransferase, long chain base subunit 1) also resides in focal adhesions, which suggests that it either plays a role in, or is essential for maintaining the normal morphology of cell. As this protein contains the transcription cofactor motif (LXXLL), it might also act as a transcriptional co-regulator that shuttles between the nucleus and cytoplasm. Mutations in SPTLC1 are associated with hereditary sensory neuropathy type 1 (HSN1), which is characterized by length-dependent axonal degeneration. HSN1 cells show abnormalities in mitochondria and ER stress, which are the results of SPTLC1 mutations. Mutation in Ser331residue of this protein, is linked to the early-onset and severe phenotype of HSN1.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71690

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library