Skip to Content
Merck
CN

HPA014063

Anti-MARCH2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

enhanced validation

Enhanced Validation

Synonym(s):

Anti-E3 ubiquitin-protein ligase MARCH2, Anti-MARCH-II, Anti-Membrane-associated RING finger protein 2, Anti-Membrane-associated RING-CH protein II, Anti-RING finger protein 172

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MARCH2(51257)

General description

The gene MARCH2 (membrane associated ring-CH-type finger 2) encodes a membrane-bound E3 ubiquitin ligase that belongs to the MARCH (Membrane-associated RING-CH) family of proteins. These proteins contain conserved PDZ (PSD-95, Dlg1, ZO-1) binding motifs. MARCH2 is ubiquitously expressed and it localizes to endosomal vesicles and the plasma membrane. The gene is mapped to human chromosome 19p13.2.

Immunogen

E3 ubiquitin-protein ligase MARCH2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The protein MARCH2 (membrane associated ring-CH-type finger 2) functions as an E3 ubiquitin ligase and uniquitinates and degrades CFTR (cystic fibrosis transmembrane conductance regulator) via its interaction with the adaptor proteins CAL (CFTR-associated ligand) and STX6 (syntaxin 6). Overexpression of this protein is found to negatively regulate the cell surface expression of transferrin (Tf) receptor and its uptake. It also inhibits the delivery of internalized Tf to perinuclear recycling endosomes. It is involved in the regulation of endosomal trafficking. It is found to co-localize with DLG1 (Disks large homolog 1), a PDZ (PSD-95, Dlg1, ZO-1) domain containing protein, at sites of cell-cell contact in a PDZ domain dependent manner and promote DLG1 ubiquitination.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72833

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

PPE (personal protective equipment)

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library