Skip to Content
Merck
CN

HPA014520

Sigma-Aldrich

Anti-C5AR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C5a anaphylatoxin chemotactic receptor, Anti-C5a-R, Anti-C5aR, Anti-CD88 antigen

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C5AR1(728)

General description

C5AR1 (complement component 5a receptor 1) is a G-protein coupled receptor (GPCR) belonging to the rhodopsin family. It is expressed in myeloid-lineage blood cells, as well as non-myeloid cells such as epithelial cells of bronchi and alveolus, and astrocytes. Its ligand is C5a, and binds to it through two sites of ligand-binding domain. One site binds to the C-terminal of C5a and the other site is a part of the N-terminal of C5AR1. C5AR1 along with two more receptors, C3AR and C5L2, make up the anaphylatoxin (AT) receptor family of the complement system.

Immunogen

C5a anaphylatoxin chemotactic receptor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

C5AR1 (complement component 5a receptor 1) binds to C5a, which results in G-protein dependant cellular activation. This includes rise in intracellular Ca2+ concentration and activation of mitogen-activated protein kinase (MAPK), PKB/Akt and phosphoinositide 3-kinase pathways. C5a is an anaphylatoxin, which has potent pro-inflammatory actions, and is involved in the pathogenesis of asthma, rheumatoid arthritis and sepsis. C5AR is involved in immunity against pathogens such as, bacteria like P. aeruginosa. It initiates their phagocytosis and degradation. It is expressed on Müller cells, which are glial cells found in eye. C5AR might be involved in the pathogenesis of retinal diseases such as, diabetic retinopathy (DR), by inducing the production of IL (interleukin)-6 and VEGF (vascular endothelial growth factor).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72794

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yves Laumonnier et al.
Current allergy and asthma reports, 11(2), 122-130 (2010-12-21)
Allergic rhinitis and asthma are common chronic inflammatory diseases of the nasal mucus membranes and the upper airways with a high prevalence in Western countries. In addition to maladaptive T-helper type 2 (Th2) immunity, Th17 cells can drive the inflammatory
Lijia Cheng et al.
Investigative ophthalmology & visual science, 54(13), 8191-8198 (2013-11-23)
Müller cells, a major type of glial cell found in the eye, are postulated to play an important role in many retinal diseases, including diabetic retinopathy (DR). Complement is an integral part of innate immunity, and the activation of complement
Eren Erken et al.
Molecular biology reports, 37(1), 273-276 (2009-08-07)
Familial Mediterranean fever (FMF) is a genetic disorder with acute inflammatory serosal attacks due to MEFV gene mutations which resides in chromosome 16. Lack of a C5a inhibitor activity in the peritoneum has previously been proposed in part to contribute
Marie-Josèphe Rabiet et al.
The Journal of biological chemistry, 283(45), 31038-31046 (2008-09-06)
Most G-protein-coupled receptors (GPCRs) form di(oligo)-meric structures that constitute signaling and trafficking units and might be essential for receptor functions. Cell responses to complement C5a receptor (C5aR) are tightly controlled by receptor desensitization and internalization. To examine the implication of
Katrine T Callesen et al.
Biomedicines, 10(5) (2022-05-29)
Mast cells (MCs) are distributed in tissues throughout the body and are highly involved in many physiological and pathophysiological processes. The potential and involvement of different MC phenotypes are still not well understood. MCs are present in blood vessel walls

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service