Skip to Content
Merck
CN

HPA017377

Anti-CDON antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CDO, Anti-CDON1, Anti-ORCAM

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
5
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

KSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVW

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... CDON(50937)

Looking for similar products? Visit Product Comparison Guide

General description

Cell adhesion molecule-related, downregulated by oncogenes (CDON) gene is mapped to human chromosome 11q23–24. The CDO protein encoded by this gene is a known cell surface receptor of the immunoglobulin superfamily This cell surface protein consists of five Ig repeats and three fibronectin type III (FNIII) repeats in its extracellular region, a transmembrane domain and a peculiar 270 amino acid intracellular region.

Immunogen

Cell adhesion molecule-related/down-regulated by oncogenes precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Cell adhesion molecule-related, downregulated by oncogenes (CDON) acts as a tumor suppressor gene in neuroblastomas. It acts as a high potential therapeutic target for PCa (prostate cancer). CDON functions as a receptor in SHH (sonic hedgehog) signaling pathway involved in neural crest cell fate during embryonic development. It is also known to activate apoptotic process in the absence of SHH pathway. CDO protein enhances myocardium formation of pluripotent stem cells.
Nonsense mutation of CDON gene involved in SHH signaling will lead to congenital defect called as holoprosencephaly (HPE).
CDO associates with co-receptor BOC (brother of CDO[cell adhesion molecule, down-regulated by oncogenes)] by mutually linking their internal domains and ectodomains. This complex is involved in the regulation of myogenic differentiation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71633

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation.
Kang JS
The Embo Journal, 21(1-2), 114-124 (2002)
Identification of transmembrane protein in prostate cancer by the Escherichia coli ampicillin secretion trap: expression of CDON is involved in tumor cell growth and invasion.
Hayashi T
Pathobiology, 78(5), 277-284 (2011)
A Nonsense Mutation in the Hedgehog Receptor CDON Associated With Pituitary Stalk Interruption Syndrome.
Bashamboo A
The Journal of Clinical Endocrinology and Metabolism, 101(1), 12-15 (2016)
A Shh coreceptor Cdo is required for efficient cardiomyogenesis of pluripotent stem cells.
Jeong MH
Journal of Molecular and Cellular Cardiology, 93, 57-66 (2016)
Regulation by miR181 family of the dependence receptor CDON tumor suppressive activity in neuroblastoma.
Gibert B
Journal of the National Cancer Institute, 106(11) (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service