Skip to Content
Merck
CN

HPA023474

Sigma-Aldrich

Anti-AGAP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-AGAP-2, Anti-Arf-GAP, GTPase, ANK repeat and PH domain-containing protein 2, Anti-Centaurin-gamma-1, Anti-GGAP2, Anti-GTP-binding and GTPase-activating protein 2, Anti-PIKE, Anti-Phosphatidylinositol-3-kinase enhancer

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AGAP2(116986)

General description

The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) belongs to the group of proteins called AZAPs that contain a catalytic core of PH (pleckstrin homology), Arf GAP and two or more ankyrin repeat domains. The AZAP family is further divided into four subfamilies, of which AGAPs contain an NH2-terminal GTPase-like domain (GLD), a split PH domain, and the GAP domain followed by four ankyrin repeats. Agap2 is found to be overexpressed in various human cancers.

Immunogen

Arf-GAP, GTPase, ANK repeat and PH domain-containing protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) encodes an Arf GAP (GTPase activating protein) that catalyzes the hydrolysis of GTP bound to Arf (ADP-ribosylation factors). The AGAPs are involved in the regulation of membrane trafficking and remodeling of the actin cytoskeleton. AGAP2 is found to associate with the clathrin adaptor protein AP-1 (activator protein 1) and participate in endosomal trafficking that is dependent on AP-1/Rab4 (RAS-related GTP-binding protein). It is also involved in facilitating the invasion of glioblastoma cells. Agap2 interacts with FAK (focal adhesion kinase) to form a complex and increase its activity, thereby promoting focal adhesion disassembly, resulting in increased cell migration.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73835

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sigrid Nakken et al.
Cancer cell international, 21(1), 690-690 (2021-12-22)
Clear cell renal cell carcinoma (ccRCC) is the most common subtype of renal cancer and one of the most common cancers. While survival for localized ccRCC is good, the survival of metastatic disease is not, and thirty percent of patients
Arf GTPase-activating protein AGAP2 regulates focal adhesion kinase activity and focal adhesion remodeling.
Zhu Y
The Journal of Biological Chemistry, 284, 13489-13496 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service