Skip to Content
Merck
CN

HPA036196

Anti-MERTK antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-C-mer proto-oncogene tyrosine kinase, Anti-Mer, Anti-RP38

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

HASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFY

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MERTK(10461)

General description

MER proto-oncogene, tyrosine kinase (MERTK) is encoded by the gene mapped to human chromosome 2q14.1. MERTK is a member of the Tyro3, Axl, and Mertk (TAM) family of receptor tyrosine kinases. MERTK is mainly expressed in macrophages, ovary, prostate, testis, lung and kidney. The protein is characterized with a conserved intracellular kinase domain and an extracellular adhesion molecule-like domain.

Immunogen

MER proto-oncogene, tyrosine kinase

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MERTK antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

MER proto-oncogene, tyrosine kinase (MERTK) is mainly involved in the starting of efferocytosis, which is the removal of dying cells by phagocytosis. It interacts with two ligands, gas6 (growth arrest-specific 6) and protein-S. Mutation in this gene, rs4374383 G>A, regulates the severity of fibrosis in patients with non-alcoholic fatty liver disease. Mutations in MERTK gene also result in autosomal recessive retinal degeneration due to faults in phagocytosis. MERTK is upregulated in malignant cells, including leukemia, lymphoma and colorectal cancer. Variants of this gene are detected in melanoma, multiple myeloma, renal cancer and carcinoma. MERTK is also overexpressed in sclerotic lesions.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST79591

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Jun Ho Yi et al.
Oncotarget, 8(57), 96656-96667 (2015-04-20)
The role of MerTK has not been assessed in gastric cancer (GC). The aim of this study was to identify a subgroup of GC patients with MerTK tumor overexpression, and to evaluate MerTK as a potential therapeutic target in this
MERTK as a novel therapeutic target in head and neck cancer.
von Massenhausen A, et al.
Oncotarget, 7(22), 32678-32678 (2016)
MerTK is a novel therapeutic target in gastric cancer.
Yi J H, et al.
Oncotarget, 8(57), 96656-96656 (2017)



Global Trade Item Number

SKUGTIN
HPA036196-100UL04061836353322