Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
6
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200
immunogen sequence
PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GPD1(2819)
General description
Glycerol-3-phosphate dehydrogenase 1 (GPD1) is encoded by the gene mapped to human chromosome 12q13.12. The encoded protein is a member of NAD-dependent glycerol-3-phosphate dehydrogenase family. GPD1 is a cytoplasmic protein with NAD_Gly3P_dh_N and NAD_Gly3P_dh_C domains.
Immunogen
glycerol-3-phosphate dehydrogenase 1 (soluble) recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Glycerol-3-phosphate dehydrogenase 1(GPD1) has been used in western blot analysis.
Biochem/physiol Actions
Glycerol-3-phosphate dehydrogenase 1 (GPD1) facilitates the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide(NADH) to glycerol-3-phosphate (G3P) and nicotinamide adenine dinucleotide (NAD+). GPD1 along with a mitochondrial enzyme, glycerol-3 phosphate dehydrogenase 2 (GPD2), plays an essential role in carrying reducing equivalents from the cytosol to the mitochondria.1It also stimulates growth under osmotic stress. Loss of gene function inhibits glycerol production, retard growth at all under anoxic conditions and strong osmosensitivity. Mutation in the gene is associated with the development of transient infantile hypertriglyceridemia, fatty Liver and hepatic fibrosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST81141
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-GPD1 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.