Skip to Content
Merck
CN

HPA045537

Sigma-Aldrich

Anti-EIF4EBP3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-4E-BP3, Anti-Eukaryotic Translation Initiation Factor 4E Binding Protein 3

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EIF4EBP3(8637)

General description

4E-BP3 (eIF4E-binding protein 3) belongs to the eukaryotic initiation factor 4E-binding protein family. It has three exons (A, B and C) and two introns. 4E-BP3 is expressed at high level in the liver than in kidney. This gene is mapped to human chromosome 5q31.3.

Immunogen

eukaryotic translation initiation factor 4E binding protein 3 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

4E-BP3 (eIF4E-binding protein 3) modulates nuclear mRNA export, mediated by eIF4E and communicates with replication protein A2. Overexpression of 4E-BP3 decreases eIF4E-dependent translation. 4E-BP3 is a heat stable protein that has the ability to connect to eIF4E in vitro and in vivo.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST84597

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Gene fusion and overlapping reading frames in the mammalian genes for 4E-BP3 and MASK.
Poulin F, et al.
The Journal of Biological Chemistry (2003)
4E?BP3 regulates eIF4E?mediated nuclear mRNA export and interacts with replication protein A2.
Chen CC, et al.
Febs Letters, 586(16), 2260-2266 (2012)
4E-BP3, a new member of the eukaryotic initiation factor 4E-binding protein family.
Poulin F, et al.
The Journal of Biological Chemistry, 273(22), 14002-14007 (1998)
Yoshinori Tsukumo et al.
Nature communications, 7, 11776-11776 (2016-06-21)
Targeting mTORC1 is a highly promising strategy in cancer therapy. Suppression of mTORC1 activity leads to rapid dephosphorylation of eIF4E-binding proteins (4E-BP1-3) and subsequent inhibition of mRNA translation. However, how the different 4E-BPs affect translation during prolonged use of mTOR

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service