Skip to Content
Merck
CN

MSST0038

SILuLite IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonym(s):

IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.12
UNSPSC Code:
23201100
Form:
lyophilized powder
Assay:
≥98% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in HEK 293 cells
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

human

recombinant

expressed in HEK 293 cells

assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98 Heavy amino acids incorporation efficiency by MS

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (internal calibrator)

UniProt accession no.

storage temp.

−20°C

Quality Level

Gene Information

human ... IGFBP7(3490)

Related Categories

General description

IGFBP7 (insulin-like growth factor-binding protein 7) belongs to the IGFBP superfamily and is widely expressed in tissues. It contains 11 cysteines, a heparin binding site, a kazal-type trypsin inhibitor domain and a carboxyl-terminal immunoglobulin-like type C repeat. IGFBP7 binds weakly to IGFs (insulin like growth factors) and strongly to insulin. It mainly participates in IGF-independent pathways. The IGFBP7 gene is mapped to human chromosome 4q12.
SILu Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Immunogen

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Biochem/physiol Actions

IGFBP7 (insulin-like growth factor-binding protein 7) acts as a tumor suppressor as well as an oncogene by controlling cell proliferation, cell attachment, apoptosis and angiogenesis. It is also involved in TGFβ (transforming growth factor beta) signal pathway. IGFBP7 interferes with the insulin pathway and is associated with the development of diabetes as well as cardiovascular diseases.
SILuLite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Methylation status of insulin-like growth factor-binding protein 7 concurs with the malignance of oral tongue cancer.
Chen L H, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 20-20 (2015)
Yi Liu et al.
Scientific reports, 5, 10227-10227 (2015-05-20)
Metabolic syndrome (MetS), one of the major public health concerns, is regarded as the "common soil" of incidence of common chronic diseases and may increase the risk of type 2 diabetes. The predominant underlying mechanism of MetS is insulin resistance
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)

Related Content

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service