Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.12
UNSPSC Code:
23201100
Form:
lyophilized powder
Assay:
≥98% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in HEK 293 cells
Product Name
SILu™Lite IGFBP7 Insulin-like growth factor-binding protein 7 human, recombinant, expressed in HEK 293 cells, MS Protein Standard
biological source
human
recombinant
expressed in HEK 293 cells
assay
≥98% (SDS-PAGE)
form
lyophilized powder
potency
≥98 Heavy amino acids incorporation efficiency by MS
technique(s)
mass spectrometry (MS): suitable
suitability
suitable for mass spectrometry (internal calibrator)
UniProt accession no.
storage temp.
−20°C
Quality Level
Gene Information
human ... IGFBP7(3490)
Related Categories
Biochem/physiol Actions
IGFBP7 (insulin-like growth factor-binding protein 7) acts as a tumor suppressor as well as an oncogene by controlling cell proliferation, cell attachment, apoptosis and angiogenesis. It is also involved in TGFβ (transforming growth factor beta) signal pathway. IGFBP7 interferes with the insulin pathway and is associated with the development of diabetes as well as cardiovascular diseases.
SILu™Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
General description
IGFBP7 (insulin-like growth factor-binding protein 7) belongs to the IGFBP superfamily and is widely expressed in tissues. It contains 11 cysteines, a heparin binding site, a kazal-type trypsin inhibitor domain and a carboxyl-terminal immunoglobulin-like type C repeat. IGFBP7 binds weakly to IGFs (insulin like growth factors) and strongly to insulin. It mainly participates in IGF-independent pathways. The IGFBP7 gene is mapped to human chromosome 4q12.
SILu™ Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Immunogen
HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class
11 - Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Methylation status of insulin-like growth factor-binding protein 7 concurs with the malignance of oral tongue cancer.
Chen L H, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 20-20 (2015)
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)
Yi Liu et al.
Scientific reports, 5, 10227-10227 (2015-05-20)
Metabolic syndrome (MetS), one of the major public health concerns, is regarded as the "common soil" of incidence of common chronic diseases and may increase the risk of type 2 diabetes. The predominant underlying mechanism of MetS is insulin resistance
Related Content
Instructions
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service