Skip to Content
Merck
CN

MSST0059

Sigma-Aldrich

SILuProt CST3, Cystatin C human

recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled

Synonym(s):

CST3, Cystatin C

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
23201100
NACRES:
NA.32
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in E. coli

Quality Level

Assay

≥95% (SDS-PAGE)

form

lyophilized powder

potency

≥97% (Heavy amino acids incorporation efficiency by MS)

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

shipped in

ambient

storage temp.

−20°C

Gene Information

human ... CST3(1471)

General description

SILuProt CST3 is a recombinant, stable 15N isotope-labeled human CST3. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of CST3 in mass-spectrometry. SILuProt CST3 is a protein of 120 amino acids, with a calculated molecular mass of 13.5 kDa.

Biochem/physiol Actions

Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine.

Other Notes

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Related Content

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service