SAB1401325
Anti-RAC3 antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RAC3(5881)
General description
Rac family small GTPase 3 (RAC3) gene is located on human chromosome 17q25.3. RAC3 is expressed in neurons of ganglia and the central nervous system.
Immunogen
RAC3 (NP_005043.1, 1 a.a. ~ 192 a.a) full-length human protein.
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
Biochem/physiol Actions
Rac family small GTPase 3 (RAC3) helps in intracellular signalling. RAC3 activity is regulated by breakpoint cluster region (Bcr). Rac3 is a potential therapeutic target for lung adenocarcinoma. Rac3 acts as a negative regulator of autophagy.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
The Journal of Biological Chemistry, jbc-M111 (2011)
A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
Test, jbc-M111 (2011)
A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
The Journal of biological chemistry, jbc-M111 (2011)
The small GTPase RAC3 gene is located within chromosome band 17q25. 3 outside and telomeric of a region commonly deleted in breast and ovarian tumours
Morris CM, et al.
Cytogenetic and genome research, 89(1-2), 18-23 (2000)
GTP-binding proteins of the Rho/Rac family: regulation, effectors and functions in vivo
Bustelo, et al.
Bioessays, 29(4), 356-370 (2007)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service