Skip to Content
Merck
CN

SAB1401325

Sigma-Aldrich

Anti-RAC3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RAC3(5881)

General description

Rac family small GTPase 3 (RAC3) gene is located on human chromosome 17q25.3. RAC3 is expressed in neurons of ganglia and the central nervous system.

Immunogen

RAC3 (NP_005043.1, 1 a.a. ~ 192 a.a) full-length human protein.

Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

Biochem/physiol Actions

Rac family small GTPase 3 (RAC3) helps in intracellular signalling. RAC3 activity is regulated by breakpoint cluster region (Bcr). Rac3 is a potential therapeutic target for lung adenocarcinoma. Rac3 acts as a negative regulator of autophagy.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
The Journal of Biological Chemistry, jbc-M111 (2011)
A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
Test, jbc-M111 (2011)
A role for the Rac3 GTPase in autophagy regulation
Zhu, Wan et al.
The Journal of biological chemistry, jbc-M111 (2011)
The small GTPase RAC3 gene is located within chromosome band 17q25. 3 outside and telomeric of a region commonly deleted in breast and ovarian tumours
Morris CM, et al.
Cytogenetic and genome research, 89(1-2), 18-23 (2000)
GTP-binding proteins of the Rho/Rac family: regulation, effectors and functions in vivo
Bustelo, et al.
Bioessays, 29(4), 356-370 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service