Skip to Content
Merck
CN

SAB1402250

Monoclonal Anti-LAMP2 antibody produced in mouse

clone 2G10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

CD107b, LAMPB, LGP110

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G10, monoclonal

form

buffered aqueous solution

mol wt

antigen ~36.89 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LAMP2(3920)

General description

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. (provided by RefSeq) Lysosome-associated membrane protein 2 (LAMP2) is expressed in the lysosomal lumen and membrane. In the tumor microenvironment, it is found to be present in the plasma membrane. The gene encoding this protein is localized on human chromosome Xq24.

Immunogen

LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP

Application

Monoclonal Anti-LAMP2 antibody produced in mouse has been used in immunofluorescence.

Biochem/physiol Actions

Lysosome-associated membrane protein 2 (LAMP2) protects lysosomal membranes from acid proteolysis. It serves as an acidity biomarker in spheroids and xenografts.The protein also has a role in maturation of autophagic vacuoles and cell-cell or cell-extracellular matrix adhesion. Mutation in the LAMP2 gene has been linked to cardiomyopathy in young patients.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane.
Damaghi M
Nature Communications (2015)
Mahogunin ring finger 1 confers cytoprotection against mutant SOD1 aggresomes and is defective in an ALS mouse model
Deepak Chhangani
Neurobiology of Disease (2016)
Unique properties of lamp2a compared to other lamp2 isoforms
Journal of Cell Science (2000)
Clinical outcome and phenotypic expression in LAMP2 cardiomyopathy
Barry Maron
JAMA : The Journal of the American Medical Association (2009)
A Crucial Sequence for Transglutaminase Type 2 Extracellular Trafficking in Renal Tubular Epithelial Cells Lies in Its N-terminal ?-Sandwich Domain
Che-Yi
The Journal of Biological Chemistry (2011)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service