SAB1402307
Monoclonal Anti-PGK1, (C-terminal) antibody produced in mouse
clone 2H4, purified immunoglobulin, buffered aqueous solution
Synonym(s):
MGC117307, MGC142128, MGC8947, MIG10, PGKA
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2H4, monoclonal
form
buffered aqueous solution
mol wt
antigen ~36.41 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PGK1(5230)
Related Categories
General description
The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19. (provided by RefSeq) Phosphoglycerate kinase 1 (PGK1) is a glycolytic enzyme. The gene encoding it is localized on human chromosome X.
Immunogen
PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Sequence
SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Biochem/physiol Actions
Phosphoglycerate kinase 1 (PGK1) converts 1, 3-diphosphoglycerate to 3-phosphoglycerate. Mitochondrial PGK1 phosphorylates pyruvate dehydrogenase kinase 1. PGK1 may have a role in rheumatoid arthritis. The protein is upregulated in various cancers. It is regulated by hypoxia-inducible factor-1α. It also has a role in DNA repair and angiogenesis. Deficiency of the enzyme is linked to combinations of hemolytic anemia, neurological dysfunction and myopathy.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Refinement of Linkage of Human Severe Combined
Immunodeficiency (SCIDX I) to Polymorphic Markers in Xq 1 3
Immunodeficiency (SCIDX I) to Polymorphic Markers in Xq 1 3
Jennifer M. Puck
American Journal of Human Genetics (1993)
Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
Tamai M
International Journal of Hematology (2014)
PGK1, a glucose metabolism enzyme, may play an important role in rheumatoid arthritis.
Zhao Y
Inflammation Research (2016)
Phosphoglycerate kinase-1 is a predictor of poor survival and a novel prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
Sun S
British Journal of Cancer (2015)
Mitochondria-Translocated PGK1 Functions as a Protein Kinase to Coordinate Glycolysis and the TCA Cycle in Tumorigenesis.
Li X
Molecular Cell (2016)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service