Monoclonal Anti-SLC7A8, (C-terminal) antibody produced in mouse

Solute carrier family 7 member 8 (SLC7A8), also known as L-amino acid transporter-2 (LAT-2), is part of the amino acid transporters family. It is a subunit of the heavy chain of the surface antigen 4F2 (4F2hc). The protein is expressed in the placenta and fetal capillaries. The SLC7A8 gene is localized on human chromosome 14q11.2.

SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Solute carrier family 7 member 8 (SLC7A8) is involved in amino acid transport.It has a role in absorption of neutral amino acids in the kidney. Mutations in the gene encoding this protein have been linked to lysinuric protein intolerance.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.