Skip to Content
Merck
CN

SAB1407352

Sigma-Aldrich

Anti-VENTX antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):

HPX42B, MGC119910, MGC119911, NA88A, VENTX2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~27.6 kDa

species reactivity

human

technique(s)

indirect immunofluorescence: suitable
western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... VENTX(27287)

General description

This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas (provided by RefSeq). Vent homeobox (VENTX) is a human homeobox transcription factor. VENTX is majorly expressed in human myeloid cells. VENTX gene is located on human chromosome 10q26.3.

Immunogen

VENTX (NP_055283.1, 1 a.a. ~ 258 a.a) full-length human protein.

Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

Biochem/physiol Actions

Vent homeobox(VENTX) regulates proliferation and differentiation of hematopoietic cells.VENTX acts as a tumor suppressor and plays an important role in proinflammatory activation.Dysregulation of VENTX may contribute to pathogenesis of autoimmune diseases.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells
Wu X, et al.
The Journal of Biological Chemistry, M113-M113 (2014)
The homeobox transcription factor VentX controls human macrophage terminal differentiation and proinflammatory activation
Wu X, et al.
The Journal of Clinical Investigation, 121(7) (2011)
Homeobox protein VentX induces p53-independent apoptosis in cancer cells
Gao H, et al.
Oncotarget, 7(26), 39719-39719 (2016)
VENTX induces expansion of primitive erythroid cells and contributes to the development of acute myeloid leukemia in mice
Gentner E, et al.
Oncotarget, 7(52), 86889-86889 (2016)
Classification and nomenclature of all human homeobox genes
Holland PWH, et al.
BMC Biology, 5(1), 47-47 (2007)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service