Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
ANTI-IL11 antibody produced in mouse, clone 3C6, purified immunoglobulin, buffered aqueous solution
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3C6, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
isotype
IgG2bκ
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... IL11(3589)
Related Categories
Biochem/physiol Actions
Interleukin 11 (IL11) stimulates tumorigenesis in conjunction with angiogenesis of the primary tumor and of metastatic progenies at distant organs. IL-11 signaling is considered as a rate-limiting step for the tumorigenesis in the mucosa of the gastrointestinal tract. Thus, inhibition of IL-11 signaling can be considered as an emerging therapeutic strategy for various cancers. In addition, this protein also performs a protective role by increasing platelet recovery and inflammatory responses, in sepsis patients with thrombocytopenia. Mutation in the gene increases the risk of susceptibility to Hirschsprung disease and multiple sclerosis (MS).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
The interleukin 11 (IL11) gene, with five exons spanning 7kb of genomic DNA, is mapped to human chromosome 19q13.42. The encoded protein belongs to the IL-6 family of cytokines. IL-11 is secreted by activated astrocytes.
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. (provided by RefSeq)
Immunogen
IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein.
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
D McKinley et al.
Genomics, 13(3), 814-819 (1992-07-01)
The genomic sequence of human interleukin-11 (IL11) has been isolated based on its sequence homology with a cDNA clone encoding primate IL11. The human IL11 genomic sequence is 7 kb in length and consists of five exons and four introns.
Cameron N Johnstone et al.
Cytokine & growth factor reviews, 26(5), 489-498 (2015-07-27)
Interleukin (IL)-11 is a member of the IL-6 family of cytokines that is defined by the shared use of the GP130 signal transducing receptor subunit. In addition of its long recognized activities as a hemopoietic growth factor, IL-11 has an
Bing Wan et al.
Cytokine, 76(2), 138-143 (2015-08-16)
To examine the platelet recovering and anti-inflammatory effects of IL-11 in the treatment of sepsis, accompanied with thrombocytopenia and to investigate the associated mechanisms via a case-control study. 105 patients enrolled for the study were segregated into (1) IL-11 therapy
L H Kim et al.
Neurogastroenterology and motility : the official journal of the European Gastrointestinal Motility Society, 27(10), 1371-1377 (2015-07-15)
Hirschsprung disease (HSCR) is a congenital and heterogeneous disorder characterized by the absence of enteric ganglia during enteric nervous system (ENS) development. Our recent genome-wide association study has identified a variant (rs6509940) of interleukin-11 (IL-11) as a potential susceptible locus
IL-11 in multiple sclerosis.
Xin Zhang et al.
Oncotarget, 6(32), 32297-32298 (2015-10-10)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service