SAB1412640
ANTI-ATOH7 antibody produced in mouse
clone 2B6, purified immunoglobulin, buffered aqueous solution
Synonym(s):
ATOH7, Math5, bHLHa13
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2B6, monoclonal
form
buffered aqueous solution
mol wt
antigen 30.69 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATOH7(220202)
General description
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila ′atonal,′ a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM
Immunogen
ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA
Sequence
MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service