SAB1412855
Monoclonal Anti-LRRC8A antibody produced in mouse
clone 8H9, purified immunoglobulin
Synonym(s):
Anti-FLJ10337, Anti-FLJ41617, Anti-KIAA1437, Anti-LRRC8
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Monoclonal Anti-LRRC8A antibody produced in mouse, clone 8H9, purified immunoglobulin
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
8H9, monoclonal
form
buffered aqueous solution
mol wt
antigen 36.74 kDa
species reactivity
human
technique(s)
ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2a
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... LRRC8A(56262)
Biochem/physiol Actions
Leucine rich repeat containing eight family member A (LRRC8A) plays an important role in T cell development, survival and function. It also plays an essential role in B-cell development. In mouse, mutation in the gene leads to abnormalities of B cell development. In addition, mutation in the gene is also associated with the development of non-Bruton type agammaglobulinemia in humans.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
General description
Leucine rich repeat containing eight family member A (LRRC8A) is a 94 kDa LRR-containing protein, encoded by the gene mapped to human chromosome 9q34.11. The encoded protein is ubiquitously expressed, but at higher levels on the surface of thymocytes than on other immune cells.
This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. (provided by RefSeq)
Immunogen
LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class
11 - Combustible Solids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
BTKbase: the mutation database for X?linked agammaglobulinemia.
Valiaho J, et al.
Human Mutation, 27(12), 1209-1217 (2006)
Identification of a lung cancer antigen evading CTL attack due to loss of human leukocyte antigen (HLA) class I expression
Baba T,et al.
Cancer Science, 101(10), 2115-2120 (2010)
Sonja Rutz et al.
Nature structural & molecular biology, 30(1), 52-61 (2022-12-16)
Volume-regulated anion channels (VRACs) participate in the cellular response to osmotic swelling. These membrane proteins consist of heteromeric assemblies of LRRC8 subunits, whose compositions determine permeation properties. Although structures of the obligatory LRRC8A, also referred to as SWELL1, have previously
Dawid Deneka et al.
Nature communications, 12(1), 5435-5435 (2021-09-16)
Members of the LRRC8 family form heteromeric assemblies, which function as volume-regulated anion channels. These modular proteins consist of a transmembrane pore and cytoplasmic leucine-rich repeat (LRR) domains. Despite their known molecular architecture, the mechanism of activation and the role
Tomoki Konishi et al.
The American journal of pathology, 189(10), 1973-1985 (2019-07-20)
The volume-regulated anion channel is composed of leucine-rich repeat-containing protein A (LRRC8A) and is activated by hypotonic conditions to implement the process of regulatory volume decrease. The role of LRRC8A in regulating genes related to progression of esophageal squamous cell
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service