Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
3
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
13 kDa
species reactivity
dog, horse, bovine, mouse, pig, human, sheep, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL15(3600)
General description
Interleukin-15 (IL-15), a cytokine, belongs to the 4α-helix bundle cytokine family. IL-15 gene is located on human chromosome 4q31.2.
Immunogen
Synthetic peptide directed towards the N terminal region of human IL15
Biochem/physiol Actions
Interleukin-15 (IL-15) can activate inflammatory cell recruitment, angiogenesis, and synthesis of other inflammatory cytokines. It plays a key role in the progression, homeostatic proliferation, and activation of natural killer (NK) cells, natural killer T (NKT) cells, and intestinal intraepithelial lymphocytes (IELs). IL-15 plays a crucial role in the homeostatic modulation of the cluster of differentiation 8 (CD8) memory T cells. IL-15 upregulates the expression of telomerase and aids in enhancing the proliferative capacity of NK, NKT-like, and CD8 T Cells. Mutation in the IL-15 gene results in psoriasis vulgaris.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-IL15 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Fiona Watkinson et al.
Frontiers in immunology, 11, 594620-594620 (2021-02-05)
Interleukin-15 (IL-15) is a cytokine that has been shown to expand CD8 T cell and natural killer (NK) cell populations, and therefore has potential for potentiating adoptive immune cell therapy for cancer. Previously, IL-15 has been shown to induce proliferation
X Tan et al.
Genes and immunity, 7(5), 407-416 (2006-06-23)
Previous studies have identified mRNA three isoforms encoding interleukin-15 (IL-15) that are produced through differential splicing and encode for the same mature IL-15 protein with two different signal peptides. Our analysis of mouse intestinal epithelial cells revealed two new IL-15
Xue-Jun Zhang et al.
The Journal of investigative dermatology, 127(11), 2544-2551 (2007-06-08)
Through a series of linkage analyses in a large Chinese family cohort of psoriasis, we previously identified and confirmed a non-HLA psoriasis linkage locus PSORS9 within a small region at 4q31.2-32.1. Within the critical region of the PSORS9 locus, IL-15
Global Trade Item Number
| SKU | GTIN |
|---|---|
| SAB2101148-100UL | 04061836140847 |