Skip to Content
Merck
CN

SAB2102648

Anti-UHRF2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp434B0920, Anti-DKFZp686G0837, Anti-MGC33463, Anti-NIRF, Anti-Ubiquitin-like, containing PHD and RING finger domains, 2

Sign In to View Organizational & Contract Pricing

Select a Size

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

90 kDa

species reactivity

guinea pig, horse, rabbit, human, mouse, dog, bovine, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

Q96PU4

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UHRF2(115426)

General description

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) belongs to the ubiquitin plant homeodomain RING finger (UHRF) family. The gene is located on human chromosome 9p24.1. The protein consists of ubiquitin-like (UBL) domain, tandem tudor domain (TTD), plant homeodomain (PHD) finger domain, SET and RING associated (SRA) domain and RING finger domain.

Immunogen

Synthetic peptide directed towards the middle region of human UHRF2

Biochem/physiol Actions

Ubiquitin like with PHD and ring finger domains 2 (UHRF2) encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
UHRF2 is overexpressed in colorectal cancer cells and functions as an oncogene in breast cancer cells. UHRF2 domains are required for the regulation of cell cycle network, epigenetic system and UPS (ubiquitin proteasome system). The protein plays an important role in the nuclear degradation of polyglutamine aggregates. UHRF2 is involved in the DNA damage repair of aortic vascular smooth muscle cells.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYK

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC4010

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ubiquitin-like with PHD and ring finger domains 2 is a predictor of survival and a potential therapeutic target in colon cancer
Lu S, et al.
Oncology Reports, 31(4), 1802-1810 (2014)
Uhrf2 is important for DNA damage response in vascular smooth muscle cells
Luo T, et al.
Biochemical and Biophysical Research Communications, 441(1), 65-70 (2013)
Intra-nuclear degradation of polyglutamine aggregates by the ubiquitin proteasome system
Iwata A, et al.
The Journal of Biological Chemistry (2009)
UHRF2 mRNA expression is low in malignant glioma but silencing inhibits the growth of U251 glioma cells in vitro
Wu TF, et al.
Asian Pacific Journal of Cancer Prevention, 13(10), 5137-5142 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service