Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
5
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
54 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... WT1(7490)
General description
Wilms tumor 1 (WT1) is a transcription factor with C-terminal zinc-finger motifs and an N-terminal proline/glutamine-rich DNA-binding domain. WT1 gene is mapped to human chromosome 11p13. WT1 expression occurs in the spleen, kidneys, gonads, and abdominal cavity lining during vertebrate development. WT1 exists as multiple transcript variants, resulting from alternative splicing at two coding exons. Evidence suggests the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.
Immunogen
Synthetic peptide directed towards the N terminal region of human WT1
Application
Anti-WT1 antibody produced in rabbit has been used in western blotting.
Biochem/physiol Actions
Wilms tumor 1 (WT1) participates in the homeostasis of the adrenal glands and gonads. WT1 functions as an oncogene and its expression are observed in a majority of tumors associated with neuronal, hematopoietic, epithelial, and mesenchymal tissues. It serves as a target for cancer immune therapy. WT1 displays a tumor suppressor role in acute myeloid leukemia (AML). Mutations in the WT1 gene is also implicated in the pathophysiology of Denys-Drash syndrome (DDS) and Frasier syndrome (FS).
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-WT1 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Min Hu et al.
Pediatric nephrology (Berlin, Germany), 19(10), 1160-1163 (2004-09-07)
We report a novel mutation in WT1 exon 9 (1214 A>G) resulting in an amino acid change from H to R at codon 405 in a 46 XY female patient who had congenital hypertrophic pyloric stenosis, pseudohermaphroditism masculinus, renal failure
L Yang et al.
Leukemia, 21(5), 868-876 (2007-03-16)
The Wilms' tumor 1 (WT1) gene encodes a transcription factor important for normal cellular development and cell survival. The initial discovery of WT1 as the causative gene in an autosomal-recessive condition identified it as a tumor suppressor gene whose mutations
Nicholas D Hastie
Development (Cambridge, England), 144(16), 2862-2872 (2017-08-16)
The study of genes mutated in human disease often leads to new insights into biology as well as disease mechanisms. One such gene is Wilms' tumour 1 (WT1), which plays multiple roles in development, tissue homeostasis and disease. In this
Global Trade Item Number
| SKU | GTIN |
|---|---|
| SAB2102716-100UL | 04061836173128 |
| SAB2102716-50UG | 04061833350652 |