Skip to Content
Merck
CN

SAB2102971

Sigma-Aldrich

Anti-ZRANB2 (ab1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp686J1831, Anti-DKFZp686N09117, Anti-FLJ41119, Anti-ZIS, Anti-Zinc finger, RAN-binding domain containing 2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

human, horse, rat, bovine, mouse, guinea pig, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZRANB2(9406)

Related Categories

General description

Zinc finger ran-binding domain containing protein 2 (ZRANB2) is a part of supraspliceosome. It is present in the nucleus of human cells. This protein contains a C-terminal arginine/serine rich domain and two N-terminal RanBP2-type zinc fingers. ZRANB2 gene is located on human chromosome 1p31.1.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZRANB2

Biochem/physiol Actions

ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5′-splice site selection. Zinc finger Ran-binding domain containing protein 2 (ZRANB2) promotes differential splicing of numerous primary transcripts. Alternative splicing of transcripts might be associated with cancer. ZRANB2 is upregulated in grade III ovarian serous papillary carcinoma. The C-terminal interacts with spliceosomal proteins and the N- terminal helps in RNA recognition.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: KTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

ZRANB2: Structural and functional insights into a novel splicing protein
Mangs A, et al.
The International Journal of Biochemistry & Cell Biology, 40(11) (2008)
Altered microRNA expression profiles in postmortem brain samples from individuals with schizophrenia and bipolar disorder
Moreau M, et al.
Biological Psychiatry, 69(2) (2011)
Crystallization of a ZRANB2--RNA complex
Loughlin F, et al.
Acta Crystallographica Section F, Structural Biology and Crystallization Communications, 64(12) (2008)
Yee Hwa J Yang et al.
Molecular biology reports, 40(9), 5381-5395 (2013-05-15)
Alternative splicing is a major source of protein diversity in humans. The human splicing factor zinc finger, Ran-binding domain containing protein 2 (ZRANB2) is a splicing protein whose specific endogenous targets are unknown. Its upregulation in grade III ovarian serous

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service