SAB2103221
Anti-ATP6V0D2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-ATP6D2, Anti-FLJ38708, Anti-VMA6
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
40 kDa
species reactivity
mouse, human, guinea pig, dog, rabbit, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATP6V0D2(245972)
General description
Adenosine triphosphatase V0 (ATP6V0D2) is located on human chromosome 8q21. Atp6v0d2 is an isoform of vacuolar (H+) ATPase (v-ATPase) proton pump. ATP6V0D2 is expressed abundantly in mature osteoclasts.
Immunogen
Synthetic peptide directed towards the middle region of human ATP6V0D2
Biochem/physiol Actions
Adenosine triphosphatase V0 (ATP6V0D2) helps in osteoclast maturation and bone formation. Insulin activates ATP6V0D2 through extracellular-signal-regulated kinase (ERK)1/2 pathway.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
v-ATPase V 0 subunit d2-deficient mice exhibit impaired osteoclast fusion and increased bone formation
Lee, Seou, et al.
Nature Medicine, 12(12), 1403-1403 (2006)
Weihao Zheng et al.
PLoS pathogens, 20(5), e1012205-e1012205 (2024-05-03)
Mycobacterium tuberculosis (Mtb) infects lung myeloid cells, but the specific Mtb-permissive cells and host mechanisms supporting Mtb persistence during chronic infection are incompletely characterized. We report that after the development of T cell responses, CD11clo monocyte-derived cells harbor more live
Integrated differential transcriptome maps of Acute Megakaryoblastic Leukemia (AMKL) in children with or without Down Syndrome (DS)
Pelleri,, et al.
BMC Medical Genomics, 7(1), 63-63 (2014)
Insulin enhances RANKL-induced osteoclastogenesis via ERK1/2 activation and induction of NFATc1 and Atp6v0d2
Oh, Ju He, et al.
Cellular Signalling, 27(12), 2325-2331 (2015)
Taesoo Kim et al.
Biochemical and biophysical research communications, 390(3), 585-590 (2009-10-13)
Bone homeostasis is tightly regulated by matrix-producing osteoblasts and bone-resorbing osteoclasts. During osteoclast development, mononuclear preosteoclasts derived from myeloid cells fuse together to form multinucleated, giant cells. Previously, we reported that the d2 isoform of the vacuolar (H(+)) ATPase V0
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service