Skip to Content
Merck
CN

SAB2104130

Sigma-Aldrich

Anti-ASCL2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-ASH2, Anti-HASH2, Anti-MASH2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

20 kDa

species reactivity

human, rat, bovine, dog, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ASCL2(430)

General description

Achaete scute-like 2 (Ascl2) is a basic helix-loop-helix transcription factor. The base of small and large intestinal crypts and the placenta shows its expression. This gene is mapped to human chromosome 11p15.

Immunogen

Synthetic peptide directed towards the middle region of human ASCL2

Biochem/physiol Actions

Achaete scute-like 2 (Ascl2) is a downstream target of WNT signalling. It may act as a regulatory factor, which regulates the fate of colon cancer cells. Ascl2 is also accountable for the differentiation of the trophoblast lineage in normal placenta.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Expression of an ASCL2 related stem cell signature and IGF2 in colorectal cancer liver metastases with 11p15.5 gain
Stange DE, et al.
Gut, 59(9), 1236-1244 (2010)
Yin Tian et al.
The Journal of biological chemistry, 289(52), 36101-36115 (2014-11-06)
Ascl2, a basic helix-loop-helix transcription factor, is a downstream target of WNT signaling that controls the fate of intestinal cryptic stem cells and colon cancer progenitor cells. However, its involvement in colon cancer and downstream molecular events is largely undefined;

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service