Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
6
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
154 kDa
species reactivity
mouse, rat, pig, human, horse, dog, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Quality Level
Gene Information
human ... INSR(3643)
Looking for similar products? Visit Product Comparison Guide
Related Categories
Immunogen
Synthetic peptide directed towards the middle region of human INSR
Biochem/physiol Actions
This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream media
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Shervi Lie et al.
American journal of physiology. Endocrinology and metabolism, 306(9), E1013-E1024 (2014-02-06)
This study aimed to determine whether exposure of the oocyte and/or embryo to maternal undernutrition results in the later programming of insulin action in the liver and factors regulating gluconeogenesis. To do this, we collect livers from singleton and twin
Mattias Günther et al.
Acta neurochirurgica, 156(12), 2365-2378 (2014-10-12)
Experimental CNS trauma results in post-traumatic inflammation for which microglia and macrophages are vital. Experimental brain contusion entails iNOS synthesis and formation of free radicals, NO and peroxynitrite. Shock wave trauma can be used as a model of high-energy trauma
Wasana Pratchayasakul et al.
Metabolism: clinical and experimental, 63(6), 851-859 (2014-04-20)
We previously demonstrated that obesity caused the reduction of peripheral and brain insulin sensitivity and that estrogen therapy improved these defects. However, the beneficial effect of estrogen on brain insulin sensitivity and oxidative stress in either ovariectomy alone or ovariectomy
Yuan Zhang et al.
Science signaling, 7(346), ra94-ra94 (2014-10-09)
Insulin-like growth factor 1 (IGF-1) is implicated in the nociceptive (pain) sensitivity of primary afferent neurons. We found that the IGF-1 receptor (IGF-1R) functionally stimulated voltage-gated T-type Ca(2+) (CaV3) channels in mouse dorsal root ganglia (DRG) neurons through a mechanism
Dan Tian et al.
BMC systems biology, 8, 98-98 (2014-08-15)
The insulin-like growth factor (IGF) system impacts cell proliferation and is highly activated in ovarian cancer. While an attractive therapeutic target, the IGF system is complex with two receptors (IGF1R, IGF2R), two ligands (IGF1, IGF2), and at least six high
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service