biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
7 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TFF1(7031)
General description
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa.
Trefoil factor 1 (TFF1) also known as breast cancer estrogen-inducible protein (BCEI) and pS2 protein, is highly expressed in the gastrointestinal mucosa. The protein was first characterized in the breast cancer cell line MCF-7. The gene TFF1 is localized on human chromosome 21q22.3.
Immunogen
Synthetic peptide directed towards the middle region of human TFF1
Biochem/physiol Actions
The major functions of TFF1 are mucosal repair incase of damage and maintenance of mucosal integrity. TFF1 promotes cell migration in breast cancer cells in response to estrogen. TFF1 is a tumour suppressor gene in gastric cancer and the mutation of which leads to development and progression of gastric cancer. TFF1 is an important marker in lobular endocervical glandular hyperplasia. TFF1 is a potent inhibitor of growth of calcium oxalate crystal growth in renal tubules.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Identification of human urinary trefoil factor 1 as a novel calcium oxalate crystal growth inhibitor
Chutipongtanate S, et al.
The Journal of Clinical Investigation, 115(12), 3613-3622 (2005)
Loss of heterozygosity and promoter methylation, but not mutation, may underlie loss of TFF1 in gastric carcinoma
Carvalho R, et al.
Laboratory Investigation; a Journal of Technical Methods and Pathology, 82(10), 1319-1326 (2002)
The pS2/TFF1 trefoil factor, from basic research to clinical applications
Ribieras ST, et al.
Biochimica et Biophysica Acta - Reviews on Cancer, 1378(1), F61-F77 (1998)
The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22. 3
Seib T, et al.
Genomics, 40(1), 200-202 (1997)
The estrogen-regulated protein, TFF1, stimulates migration of human breast cancer cells
Prest SJ, et al.
Faseb Journal, 16(6), 592-594 (2002)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service