Skip to Content
Merck
CN

SAB2108280

Anti-PITX3 antibody produced in rabbit

affinity isolated antibody

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32kDa

species reactivity

rat, mouse, bovine, horse, dog, sheep, human, rabbit, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PITX3(5309)

General description

The paired-like homeodomain transcription factor 3 (PITX3) is located on human chromosome 10q24. It has a characteristic homeodomain. PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human PITX3

Biochem/physiol Actions

The paired-like homeodomain transcription factor 3 (PITX3) participates in the midbrain dopamine system development. The homeodomain of PITX3 is essential for DNA binding. Single-nucleotide polymorphism in this gene is linked with Parkinson′s disease.
Members of RIEG/PITX homeobox family act as transcription factors. Mutations of PITX3 have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. PITX3 is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Functional analysis of human mutations in homeodomain transcription factor PITX3
Sakazume S, et al.
BMC Molecular Biology, 8(1), 84-84 (2007)
PITX3 DNA methylation is an independent predictor of overall survival in patients with head and neck squamous cell carcinoma
Sailer V, et al.
Clinical epigenetics, 9(1), 12-12 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service