SAB2108408
Anti-SLC16A3 antibody produced in rabbit
affinity isolated antibody
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-SLC16A3 antibody produced in rabbit, affinity isolated antibody
storage temp.
−20°C
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
50kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunoblotting: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
target post-translational modification
unmodified
Quality Level
Gene Information
human ... SLC16A3(9123)
Biochem/physiol Actions
Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT4 is upregulated in the hypoxic environment in glioblastoma, and is implicated in solid tumours like breast cancer and bladder cancer and leads to metastasis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Solute carrier family 16 member 3 (SLC16A3) encodes monocarboxylate transporter 4 (MCT4). MCT4 is targeted by the chaperone CD147 to the basolateral plasma membrane. MCT4 is highly expressed in astrocytes, skeletal muscle fibres, chondrocytes, placenta. In human chromosome, the gene SLC16A3 is located on 17q25.3.
Immunogen
Synthetic peptide directed towards the N terminal of human SLC16A3
Other Notes
Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Genetic variations of the MCT4 (SLC16A3) gene in the Chinese and Indian populations of Singapore
Lean CB and Lee EJD
Drug Metabolism and Pharmacokinetics, 27(4), 456-464 (2012)
Butyric acid increases trans epithelial transport of ferulic acid through upregulation of the monocarboxylate transporters SLC16A1 (MCT1) and SLC16A3 (MCT4)
Ziegler K, et al.
Archives of Biochemistry and Biophysics, 599, 3-12 (2016)
Identifying differential expression genes and single nucleotide variations using RNA-seq in metastatic melanoma
Liu D, et al.
Genetics and molecular research : GMR, 13, 8153-8162 (2014)
Partial maternal heterodisomy of chromosome 17q25 in a case of severe mental retardation
Rio M, et al.
Human Genetics, 108(6), 511-515 (2001)
DNA methylation of the SLC16A3 promoter regulates expression of the human lactate transporter MCT4 in renal cancer with consequences for clinical outcome
Fisel P, et al.
Clinical Cancer Research, 19(18), 5170-5181 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service