Skip to Content
Merck
CN

WH0000196M2

Monoclonal Anti-AHR antibody produced in mouse

clone 3B12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-aryl hydrocarbon receptor

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B12, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AHR(196)

General description

Aryl hydrocarbon receptor (Ahr) is a helix-loop-helix transcription factor and a heterodimeric protein. It is encoded by the gene mapped to human chromosome 7p211. The encoded protein is a member of the helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) family of transcription factors. AHRis mainly expressed in the cytoplasm and is found in a complex with chaperone proteins such as HSP90 (heat shock protein 90), XAP2 (X-associated protein 2 ) and p23 (cochaperone for the Hsp90).
This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

Immunogen

AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN

Application

Monoclonal Anti-AHR antibody produced in mouse has been used in western blot technique.

Biochem/physiol Actions

Aryl hydrocarbon receptor (Ahr) helps in the inhibitory effects of 2-(4-hydroxy-3-methoxyphenyl)-benzothiazole (YL-109) on development and invasion of MDA-MB-231 (breast adenocarcinoma cell line) by upregulation of heat shock protein 70 (Hsp70)-interacting protein (CHIP). The encoded protein regulates invasiveness and metastasis of breast cancer cells. Ahr mediates various biological responses to extensive environmental pollutants.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Polycyclic aromatic hydrocarbon components contribute to the mitochondria-antiapoptotic effect of fine particulate matter on human bronchial epithelial cells via the aryl hydrocarbon receptor
Ferecatu I
Particle and Fibre Toxicology (2010)
Human arylhydrocarbon receptor: functional expression and chromosomal assignment to 7p21.
Ema M
Journal of Biochemistry, 116, 845-851 (1994)
Induction of expression of aryl hydrocarbon receptor-dependent genes in human HepaRG cell line modified by shRNA and treated with β-naphthoflavone.
Brauze D
Molecular and Cellular Biochemistry, 425, 59-75 (2017)
Novel Aryl Hydrocarbon Receptor Agonist Suppresses Migration and Invasion of Breast Cancer Cells.
Hanieh H
PLoS ONE, 11 (2016)
Ioana Ferecatu et al.
Particle and fibre toxicology, 7, 18-18 (2010-07-29)
Nowadays, effects of fine particulate matter (PM2.5) are well-documented and related to oxidative stress and pro-inflammatory response. Nevertheless, epidemiological studies show that PM2.5 exposure is correlated with an increase of pulmonary cancers and the remodeling of the airway epithelium involving

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service