Skip to Content
Merck
CN

WH0000834M1

Monoclonal Anti-CASP1 antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ICE, Anti-IL1BC, Anti-P45, Anti-caspase 1, apoptosis-related cysteine protease (interleukin 1, beta, convertase)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Monoclonal Anti-CASP1 antibody produced in mouse, clone 3D2, purified immunoglobulin, buffered aqueous solution

shipped in

dry ice

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3D2, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... CASP1(834)

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

Caspase-1 has an ability to transform pro-inflammatory cytokines, interleukin-1 β (IL-1 β) and IL-18 into their active forms. In addition, it also participates in pyroptosis. Elevated expression of the gene has been observed in the aorta of coronary atherosclerosis patients. CASP1 helps in host cell survival by inducing membrane biogenesis to restore the impairment caused by pore-forming toxins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The caspase-1 (CASP1) /interleukin-1β converting enzyme (ICE) gene, with ten exons, is mapped to human chromosome 11q22.2. The encoded protein contains an N-terminal CARD (caspase activation and recruitment domain), a large P20 subunit and a small P10 subunit. CASP1 is distributed in leukocytes, monocytes and epithelial cells.
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms. (provided by RefSeq)

Immunogen

CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

CASP1 (caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase))
Kumar Y
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 269-275 (2007)
Monocyte Caspase-1 Is Released in a Stable, Active High Molecular Weight Complex Distinct from the Unstable Cell Lysate-Activated Caspase-1.
Shamaa OR
PLoS ONE, 10 (2015)
Overexpression of caspase-1 in aorta of patients with coronary atherosclerosis.
Zheng F
Heart, Lung & Circulation, 23, 1070-1074 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service