Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2F9, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CNR1(1268)
General description
Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.
This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)
Immunogen
CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Biochem/physiol Actions
Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Crystal Structure of the Human Cannabinoid Receptor CB1.
Hua T
Cell, 167, 750-762 (2016)
The CB1 Receptor as the Cornerstone of Exostasis.
Piazza PV
Neuron, 93, 1252-1274 (2017)
Cannabinoid receptor gene (CNR1): association with i.v. drug use.
Comings DE
Molecular Psychiatry, 2, 161-168 (1997)
The incentive salience of alcohol: translating the effects of genetic variant in CNR1.
Hutchison KE
Archives of General Psychiatry, 65, 841-850 (2008)
CNR1, central cannabinoid receptor gene, associated with susceptibility to hebephrenic schizophrenia.
Ujike H
Molecular Psychiatry, 7, 515-518 (2002)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service