WH0001906M1
Monoclonal Anti-EDN1 antibody produced in mouse
clone 3D6, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-ET1, Anti-Endothelin 1
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3D6, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... EDN1(1906)
General description
Endothelin 1 (ET1) is an endothelium-derived peptide. It is synthesized as an inactive form of 212 amino acids and later converted to an active 21 amino acid peptide. The gene encoding it is localized on human chromosome 6p24.1.
Immunogen
EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Biochem/physiol Actions
Endothelin 1 (ET1) is a vasoconstrictor and is involved in pulmonary vascular homeostasis. ET1 has been linked to HIV (human immunodeficiency virus)-associated pulmonary arterial hypertension and endothelial dysfunction.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Alexandra B Cooke et al.
Metabolism: clinical and experimental, 64(9), 1103-1111 (2015-07-05)
Endothelin-1 (ET-1) is a potent vasoconstrictor produced by vascular endothelial cells, and a known marker of endothelial dysfunction. However, the acute and chronic effects of smoking and nicotine gum on the ET-1 response to acute physical stress in young healthy
Rushi V Parikh et al.
PloS one, 11(1), e0146355-e0146355 (2016-01-12)
HIV infection is an independent risk factor for PAH, but the underlying pathogenesis remains unclear. ET-1 is a robust vasoconstrictor and key mediator of pulmonary vascular homeostasis. Higher levels of ET-1 predict disease severity and mortality in other forms of
Abdelkader Chalghoum et al.
BMC cardiovascular disorders, 15, 152-152 (2015-11-18)
Acute coronary syndromes (ACS) are complex and polygenic diseases which are a real problem of public health. These syndromes require multidisciplinary studies to understand the pathogenesis mechanisms. Our study aims to evaluate the endothelin-1 (ET-1) serum concentration in Tunisian coronary
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service