Skip to Content
Merck
CN

WH0002303M2

Monoclonal Anti-FOXC2 antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FKHL14, Anti-MFH1, Anti-forkhead box C2 (MFH-1, mesenchyme forkhead 1)

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H3, monoclonal

form

buffered aqueous solution

species reactivity

mouse, human, rat

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2bλ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXC2(2303)

General description

Forkhead Box Protein C2 (FOXC2) is a transcription factor. It belongs to the forkhead/winged-helix family of transcription factors. This gene is located on human chromosome 16q24.
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogen

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Application

Monoclonal Anti-FOXC2 antibody has been used in immunohistochemistry.

Biochem/physiol Actions

Forkhead Box Protein C2 (FOXC2) controls YAP (yes-associated protein) signaling and stimulates the progression of nasopharyngeal carcinoma by promoting glycolysis. It plays a major role in inducing invasion and metastasis. Mutations in FOXC2 result in hereditary Lymphedema-Distichiasis syndrome.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mutations in FOXC2 (MFH-1), a forkhead family transcription factor, are responsible for the hereditary lymphedema-distichiasis syndrome
Fang J,et al.
American Journal of Human Genetics, 67(6), 1382-1388 (2000)
FOXC2 positively regulates YAP signaling and promotes the glycolysis of nasopharyngeal carcinoma
Song L, et al.
Experimental Cell Research (2017)
Overexpression of forkhead Box C2 promotes tumor metastasis and indicates poor prognosis in colon cancer via regulating epithelial-mesenchymal transition
Li Q, et al.
American Journal of Cancer Research (2015)
Tomomi Yamamoto-Fukuda et al.
Journal of the Association for Research in Otolaryngology : JARO, 22(4), 405-424 (2021-04-17)
Distinct histone modifications regulate gene expression in certain diseases, but little is known about histone epigenetics in middle ear cholesteatoma. It is known that histone acetylation destabilizes the nucleosome and chromatin structure and induces gene activation. The association of histone
Sendurai A Mani et al.
Proceedings of the National Academy of Sciences of the United States of America, 104(24), 10069-10074 (2007-06-01)
The metastatic spread of epithelial cancer cells from the primary tumor to distant organs mimics the cell migrations that occur during embryogenesis. Using gene expression profiling, we have found that the FOXC2 transcription factor, which is involved in specifying mesenchymal

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service