Skip to Content
Merck
CN

WH0004205M1

Monoclonal Anti-MEF2A antibody produced in mouse

clone 3F6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ADCAD1, Anti-MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A), Anti-RSRFC4, Anti-RSRFC9

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
3F6, monoclonal
Application:
ELISA (i), IHC (p), WB
Citations:
3
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... MEF2A(4205)

Looking for similar products? Visit Product Comparison Guide

General description

MEF2A (myocyte enhancer factor 2A) belongs to the myocyte enhancer family of transcription factors. This gene codes for proteins, which helps to attach to a consensus CTA(T/A)4TAG/A sequence as homo- and heterodimers. It is mapped human to chromosome 15q26.
The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes ′agamous′ and ′deficiens′ and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.[supplied by OMIM]

Immunogen

MEF2A (AAH13437, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA

Biochem/physiol Actions

MEF2A (myocyte enhancer factor 2A) mutation is associated with an autosomal dominant form of CAD (coronary artery disease). MEF2, along with calcium modulates cell division, differentiation and death.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Novel 6-bp deletion in MEF2A linked to premature coronary artery disease in a large Chinese family
Xu DL, et al.
Molecular Medicine Reports, 14(1), 649-654 (2016)
Regional chromosomal assignments for four members of the MADS domain transcription enhancer factor 2 (MEF2) gene family to human chromosomes 15q26, 19p12, 5q14, and 1q12-q23
Hobson GM, et al.
Genomics, 29(3), 704-711 (1995)
Timothy A McKinsey et al.
Trends in biochemical sciences, 27(1), 40-47 (2002-02-14)
The decision of a cell to divide, differentiate or die is dependent on the coupling of cytoplasmic signals to the activation and repression of specific sets of genes in the nucleus. Many of the signal transduction pathways that control these

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service