Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
3D2, monoclonal
Application:
ELISA (i), IF, IHC (p), WB
Citations:
3
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3D2, monoclonal
form
buffered aqueous solution
species reactivity
rat, mouse, human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL
isotype
IgG3κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PCSK1(5122)
General description
The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known. (provided by RefSeq)
Immunogen
PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Sequence
GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Hubert Zatorski et al.
Pharmacological reports : PR, 73(6), 1670-1679 (2021-09-19)
The role of the incretin hormone, glucagon-like peptide (GLP-1), in Crohn's disease (CD), is still poorly understood. The aim of this study was to investigate whether colitis is associated with changes in blood glucose levels and the possible involvement of
Bing Bai et al.
Neuron, 105(6), 975-991 (2020-01-14)
Alzheimer's disease (AD) displays a long asymptomatic stage before dementia. We characterize AD stage-associated molecular networks by profiling 14,513 proteins and 34,173 phosphosites in the human brain with mass spectrometry, highlighting 173 protein changes in 17 pathways. The altered proteins
Lisa C Burnett et al.
The Journal of clinical investigation, 127(1), 293-305 (2016-12-13)
Prader-Willi syndrome (PWS) is caused by a loss of paternally expressed genes in an imprinted region of chromosome 15q. Among the canonical PWS phenotypes are hyperphagic obesity, central hypogonadism, and low growth hormone (GH). Rare microdeletions in PWS patients define
Global Trade Item Number
| SKU | GTIN |
|---|---|
| WH0005122M2-100UG | 04061831635133 |