WH0005791M4
Monoclonal Anti-PTPRE antibody produced in mouse
clone 2D10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-DKFZp313F1310, Anti-HPTPE, Anti-PTPE, Anti-RPTPEPSILON, Anti-protein tyrosine phosphatase, receptor type, E
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2D10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunofluorescence: suitable
indirect ELISA: suitable
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PTPRE(5791)
General description
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; Another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokines induced SATA signaling, as well as the activation of voltage-gated K+ channels. (provided by RefSeq)
Immunogen
PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Biochem/physiol Actions
PTPRE (Protein tyrosine phosphatase, receptor type, E) is associated with various signalling pathways including down regulation of insulin receptor signalling and Janus kinase (Jak)-STAT inhibition signalling pathway. It also plays an important role in the regulation of ERK1/2 pathway by emerging as a phosphatase through its catalytic activity. Study shows that it may play an accessory role in tumour development.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Assignment of the human protein tyrosine phosphatase epsilon (PTPRE) gene to chromosome 10q26 by fluorescence in situ hybridization.
A M van den Maagdenberg et al.
Genomics, 30(1), 128-129 (1995-11-01)
T Wabakken et al.
Scandinavian journal of immunology, 56(3), 276-285 (2002-08-24)
This report describes the identification and characterization of a novel cytoplasmic isoform of human protein tyrosine phosphatase epsilon (PTPepsilon). The novel isoform, denoted cyt-PTPepsilonPD1, displays only the N-terminal catalytic, active phosphatase domain 1 (PD1) which is common in all known
T Wabakken et al.
Scandinavian journal of immunology, 56(2), 195-203 (2002-07-18)
The expression of protein tyrosine phosphatase epsilon (PTPepsilon) was studied in human tissues and blood cells. High mRNA expression was observed in peripheral blood leucocytes, particularly in monocytes and granulocytes which revealed at least four distinct transcripts. In lymphocytes, PTPepsilon
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service