WH0007001M1
Monoclonal Anti-PRDX2 antibody produced in mouse
clone 4E10-2D2, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-MGC4104, Anti-NKEFB, Anti-PRP, Anti-PRXII, Anti-Peroxiredoxin 2, Anti-TDPX1, Anti-TSA
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
4E10-2D2, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PRDX2(7001)
Related Categories
General description
Peroxiredoxin 2 (PRDX2) is an antioxidant protein that belongs to the peroxiredoxins family. It is associated with mammalian erythrocytes. The PRDX2 gene is mapped to human chromosome19p13.13.
Immunogen
PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Application
Monoclonal Anti-PRDX2 antibody produced in mouse has been used in western blotting (1:1000).
Biochem/physiol Actions
Peroxiredoxin 2 (PRDX2) effectively neutralizes hydrogen peroxide (H2O2 ). It is regarded as a critical cell survival modulator and may serve as a key regulator for cell proliferation and intracellular signaling. Downregulated expression of PRDX2 is observed in acute myeloid leukemia (AML) and melanoma. However, it acts as an oncogene in the pathophysiology of various cancers including non-small cell lung cancer (NSCLC), esophageal, cervical, gastric tumors, and many more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Ting Duan et al.
Molecular medicine reports, 13(6), 4807-4813 (2016-04-16)
Late‑onset hypogonadism is defined as a condition caused by a decline in the levels of testosterone with aging. One of the major factors contributing to the low levels of testosterone is the accumulation of reactive oxygen species (ROS) in Leydig
Yun Chen et al.
BioMed research international, 2020, 8359860-8359860 (2020-09-11)
Previous studies have reported that the levels of PRDX2 were correlated with tumorigenicity, recurrence, and prognosis of patients with different cancers. We investigated the association between PRDX2 levels and the prognosis of lung cancer patients. We also measured PRDX2 expression
Kumarasamypet M Mohankumar et al.
Nature genetics, 47(8), 878-887 (2015-06-16)
Cancers are characterized by non-random chromosome copy number alterations that presumably contain oncogenes and tumor-suppressor genes (TSGs). The affected loci are often large, making it difficult to pinpoint which genes are driving the cancer. Here we report a cross-species in
Trung Nghia Vo et al.
Antioxidants (Basel, Switzerland), 10(7) (2021-07-03)
Hydrogen peroxide (H2O2) is a key redox signaling molecule that selectively oxidizes cysteines on proteins. It can accomplish this even in the presence of highly efficient and abundant H2O2 scavengers, peroxiredoxins (Prdxs), as it is the Prdxs themselves that transfer
Thiol-disulphide independent in-cell trapping for the identification of peroxiredoxin 2 interactors.
Ting Luo et al.
Redox biology, 46, 102066-102066 (2021-08-03)
Hydrogen peroxide (H2O2) acts as a signalling molecule by oxidising cysteine thiols in proteins. Recent evidence has established a role for cytosolic peroxiredoxins in transmitting H2O2-based oxidation to a multitude of target proteins. Moreover, it is becoming clear that peroxiredoxins
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service