Skip to Content
Merck
CN

WH0007461M7

Monoclonal Anti-CYLN2 antibody produced in mouse

clone 3H5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CLIP, Anti-CLIP115, Anti-CLIP2, Anti-KIAA0291, Anti-MGC11333, Anti-WBSCR4, Anti-WSCR4, Anti-cytoplasmic linker 2

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3H5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLIP2(7461)

General description

Cytoplasmic linker protein-115 (CYLN2), also known as CAP-Gly domain containing linker protein 2 (CLIP2), possesses a structural maintenance of chromosomes (Smc) domain. The gene encoding this protein is localized on human chromosome 7q11.23.

Immunogen

CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH

Biochem/physiol Actions

Cytoplasmic linker protein-115 (CYLN2) or CLIP2 takes part in cell division, segregation of chromosomes and in attaching organelles to microtubules. It may be useful as a marker in papillary thyroid carcinoma (PTC). Mutations in the gene encoding CYLN2 have been associated with Williams-Beuren syndrome and the protein has been shown to be expressed in colorectal carcinomas.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Gain of chromosome band 7q11 in papillary thyroid carcinomas of young patients is associated with exposure to low-dose irradiation.
Julia Hess
Proceedings of the National Academy of Sciences of the USA (2011)
Dose-dependent expression of CLIP2 in post-Chernobyl papillary thyroid carcinomas
Carcinogenesis, 36(36) (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service